Datasheet

Recombinant psaA protein from Streptococcus mitis (CAT#: LBGF-0626-G902)

Our Recombinant psaA protein is sourced from Streptococcus mitis and expressed via specialized heterologous hosts (E. coli, yeast, or mammalian cells) to achieve native-like conformation. We prioritize exceptional purity and low endotoxin levels to guarantee reliable performance in your experimental workflows. Detailed quality metrics, including purity and specific biological activity (where available), can be found on the lot-specific Certificate of Analysis (CoA).

For Research Use Only. Not intended for use in food manufacturing or medical procedures (diagnostics or therapeutics). Do Not Use in Humans.

SPECIFIC INQUIRY
Expression Host:
Size:
Selected Options:
Inquiry
General Information Documents Customer Reviews Related Products Inquiry
Basic Information
Product Overview Our Recombinant psaA protein is sourced from Streptococcus mitis and expressed via specialized heterologous hosts (E. coli, yeast, or mammalian cells) to achieve native-like conformation. We prioritize exceptional purity and low endotoxin levels to guarantee reliable performance in your experimental workflows. Detailed quality metrics, including purity and specific biological activity (where available), can be found on the lot-specific Certificate of Analysis (CoA).
Target psaA protein
Source Organism Streptococcus mitis
Gene/Protein Name psaA
Protein Sequence CASGKKDAASGQKLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFSKLVENAKKTENKDYFAVSEGVDVIYLEGKNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNNIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTDSIAEQGKEGDSYYNMMKYNLDKIAEGLAK
Subcellular Localization Cell membrane; Lipid-anchor.
Protein Region Full Length
UniProt Accession Number Q9L5X0
Biological Activity Not Test
Protein Family Bacterial solute-binding protein 9 family, Lipoprotein receptor antigen (Lrai) subfamily
Applications ELISA, Western Blot (WB), Immunoprecipitation (IP), Positive Control.
Note: Optimal dilutions/concentrations should be determined by the end user.
Chemical & Physical Properties
Molecular Weight 40.0 kDa
Tag&Position N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity ≥85% (SDS-PAGE)
Formulation 1. Liquid Form: Supplied in a default Tris/PBS-based storage buffer supplemented with 5%-50% glycerol.
2. Lyophilized Form: Lyophilized from a Tris/PBS-based pre-lyophilization buffer (pH 8.0) containing 6% Trehalose as a lyoprotectant.
Shipping Lyophilized Form: Shipped at ambient temperature (or with blue ice).
Liquid Form: Shipped with blue ice (or on dry ice, depending on stability).
Note: Upon receipt, please store the product immediately under the recommended conditions specified on the Certificate of Analysis (CoA).
Handling & Storage
Stability&Storage 1.Lyophilized Powder: Stored at -20°C to -80°C, the product is stable for 12 months from the date of receipt. Upon reconstitution, it is stable for up to 1 week at 2-8°C or 3 months at -20°C to -80°C.
2. Liquid Form: Stored at -20°C to -80°C, the product is stable for 6 to 12 months (avoid repeated freeze-thaw cycles). Aliquot upon arrival to prevent degradation.
Reconstitution For Lyophilized Powder. Always centrifuge tubes before opening to bring the contents to the bottom. Do not vortex.
1. Reconstitute in sterile ddH2O to a stock concentration of 0.1-1.0 mg/mL.
2. Dissolve the protein by gentle pipetting up and down or by inverting the tube.
3. Allow the solution to stand at room temperature for at least 20 minutes to ensure complete reconstitution.
4. Aliquot the reconstituted solution into working volumes and store at -20°C for long-term storage. Avoid repeated freeze-thaw cycles.
Shipping Lyophilized Form: Shipped at ambient temperature (or with blue ice).
Liquid Form: Shipped with blue ice (or on dry ice, depending on stability).
Note: Upon receipt, please store the product immediately under the recommended conditions specified on the Certificate of Analysis (CoA).
Lead Time In-stock Items: Ships within 1-2 business days.
Out-of-stock / Custom Orders: 2-4 weeks (Our team will confirm the exact timeline upon order placement).
This protein can be fully tailored to your specifications. Our platform directly supports expression host transitions, tag removal, and scalable bulk production.

Click the button below to contact us or submit your feedback about this product.


Online Inquiry

For Research Use Only. Not intended for use in food manufacturing or medical procedures (diagnostics or therapeutics). Do Not Use in Humans.

Creative Biolabs-Live Biotherapeutics


ISO 9001 Certified - Creative Biolabs Quality Management System.
Contact us

Copyright © 2026 Creative Biolabs. All Rights Reserved.

Inquiry Basket